PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_19111A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 317aa    MW: 35707.4 Da    PI: 8.8229
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_19111AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.6e-141657547
                               -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               T++Ede+l++ v+++G++ W+tIa  ++ gR + qc+ rw  +
  Oropetium_20150105_19111A 16 TEQEDEILIQMVNRHGSRKWSTIACSVP-GRNPQQCRKRWMFH 57
                               89**************************.***********865 PP

2Myb_DNA-binding42.91.1e-1365106245
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
            Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                ++W+++E+  l++a++ +G++ W+  a+ ++ gRt+k +k  w 
  Oropetium_20150105_19111A  65 QPWSEQEEIELIHAHQIHGNK-WAELAKLFP-GRTGKAVKYQWV 106
                                79*******************.*********.**********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.679158IPR017930Myb domain
PfamPF139215.2E-151675No hitNo description
Gene3DG3DSA:1.10.10.602.3E-201665IPR009057Homeodomain-like
SuperFamilySSF466894.87E-2516105IPR009057Homeodomain-like
CDDcd001677.53E-121658No hitNo description
SMARTSM007177.3E-81660IPR001005SANT/Myb domain
PROSITE profilePS5129417.90559113IPR017930Myb domain
SMARTSM007173.5E-1363111IPR001005SANT/Myb domain
CDDcd001671.91E-1066108No hitNo description
Gene3DG3DSA:1.10.10.604.5E-1766112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MLKSKELLNV SSLMRTEQED EILIQMVNRH GSRKWSTIAC SVPGRNPQQC RKRWMFHLNP  60
AVNQQPWSEQ EEIELIHAHQ IHGNKWAELA KLFPGRTGKA VKYQWVRLNN KNVKSHLFKG  120
LPEQFARRPI DSSIKDNKGP STNKSIEDSS TNIHVQSEMP VSPNLEHALT GAARNPSTLK  180
GKASDIMPDK GSTPHSSVND SQMVDGQIIA SYPWSQKDEE KTDSVAIQPN SVNTDLCPAR  240
NLLSRGDHSD EICSSDDSES QNPHLGNLAD LLDMDCIRRP RRSQELCPLG LGLRKLKLKI  300
SDTRKIKKET FHFDLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-251610511100B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952183.12e-81PREDICTED: myb-related protein 3R-1-like
TrEMBLA0A0A9MNE48e-99A0A0A9MNE4_ARUDO; Uncharacterized protein
STRINGSi017987m2e-69(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16796912
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.11e-34myb domain protein 3r-4